PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G000700.1.p
Common NameGLYMA_13G000700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 700aa    MW: 81829.9 Da    PI: 6.2853
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G000700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1423.1e-13168237172
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkek 72 
                          +fY+ YAk+ GFs+rks+  ++ +  ++ ++tfvCs+ g+r+ ++++ ++ +r+++e+r+gC+a++ v++ +
  Glyma.13G000700.1.p 168 QFYCWYAKSNGFSIRKSHIVRN-TCMKTLQQTFVCSCAGYRRVSTSD-RRMQREKKESRCGCEAMFCVHNFD 237
                          6******************999.555599**************9999.99999*************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-10168236IPR004330FAR1 DNA binding domain
PfamPF105511.7E-28350444IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MCKVRGCYFW CFICLKMMWK ILKIKVITEY VFDYSHRIRK YMFPYCAFVC QVRSPVNVMD  60
LDDIMSELES SDNFCSFVNG DGDNDVTEVY PNDDDDQHDV RLEDEDEVDS EVHNDDGGDY  120
DDFWIPGLLK EECISIDSMI DIRQFDMEEI TDEVVRRLDF GDLELAYQFY CWYAKSNGFS  180
IRKSHIVRNT CMKTLQQTFV CSCAGYRRVS TSDRRMQREK KESRCGCEAM FCVHNFDHNH  240
LLLDLKLSCL LLGHRKMFAF DIMQVENYRK VGIRPPHMHA TFANQCGGYD KVWFIRKDIY  300
NEEGRMRKQH TSDGSGALKY LHDLRKKDPM MYVSYTADEG SGLQQLFWDV LAFDATYKEN  360
KYLCPFVVFT SVSNHNQTIV FAAAVVTDET EETYVWLLEQ LLVAMKGKTP SSIITDGYLA  420
MRNAITRIML GVFHRLCAWH LLRNALSHVR DKQVLKWLKK LMLGDFEVVE FEEKWKEMVA  480
TFELEDNTWI AELYEKRMKW SPAHLRGYFF AGIQTTSRCE AFHAHVAKYV HSRTNLTDFS  540
YLCRTIKLRV VDCKEMVAFS IYTVVKYCSG SVWLVSYCPS TVDFSRSCMR MKSIGLPCDH  600
ILVVLVSLNF MELPSSLVLS KWSKVATENI KDKYLDSAMY WDSQLMARYA TLVEVSRQVC  660
EAAYCDEEEY DKMLHFLSNE ARRLKSKKNR QPCVDDNND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351390.0AC235139.1 Glycine max strain Williams 82 clone GM_WBa0065P04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590087.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0R0GQE50.0A0A0R0GQE5_SOYBN; Uncharacterized protein
STRINGGLYMA11G29330.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3265734
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-52FAR1-related sequence 5